PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_18374A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family CO-like
Protein Properties Length: 387aa    MW: 40557.8 Da    PI: 7.0825
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_18374AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.21.1e-051453440
                   zf-B_box  4 rkCpeHee.kelqlfCedCqq.llCedClleeHkg..Htvv 40
                               r+C  ++   ++  +C++C+  +lC+ C    H +  H++v
  Oropetium_20150105_18374A 14 RRCGACGGgTPAAVHCRTCEGaYLCAVCDAG-HARagHERV 53
                               79*****8799********977********9.977889875 PP

2zf-B_box24.17.2e-085398342
                   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                                ++C+ +e+ ++   C+ +   lC+ C   +H        H++vp+
  Oropetium_20150105_18374A 53 VWVCEVCERAPAAVTCRADAAALCAACDADIHDAnplarrHERVPV 98
                               689*****************************44788888999986 PP

3CCT68.22.3e-23293336144
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                R+a+llRY+eKrk+R+FeK+irY+sRKa+AesRpRvKGrF+k++
  Oropetium_20150105_18374A 293 RAARLLRYREKRKNRRFEKTIRYASRKAYAESRPRVKGRFAKRT 336
                                99***************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0141155IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8655198IPR000315B-box-type zinc finger
PfamPF006438.3E-65298IPR000315B-box-type zinc finger
SMARTSM003367.9E-95698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.728293335IPR010402CCT domain
PfamPF062032.2E-17293335IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MDGGLGRYWG VGGRRCGACG GGTPAAVHCR TCEGAYLCAV CDAGHARAGH ERVWVCEVCE  60
RAPAAVTCRA DAAALCAACD ADIHDANPLA RRHERVPVHP IGSSSISLPF AAAAAAAESP  120
SGMVTTTMSM LGGAVGDDGG KHDAAKLDCF LFADDVMDRH PFTMSPDEAA RVPHAADRVV  180
PNDGSSGGSA VELDFGGAVV AVKAKPSYSS VAHSGSSSEV GLVPDAICGR GGSVTGGVIE  240
LDFAQSKAAY LPYAMTPTHS VTSSVDVGAV VPDNRISXXX XXXXXXXXXA ESRAARLLRY  300
REKRKNRRFE KTIRYASRKA YAESRPRVKG RFAKRTTDTD DNEEHDAAAA VALAPXXXXX  360
XXXXXXTTSA YPYVLDFSGY GVVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3646242e-38AK364624.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2027A16.
GenBankAK3672192e-38AK367219.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2053C02.
GenBankAY0829602e-38AY082960.1 Hordeum vulgare CONSTANS-like protein CO6 (CO6) gene, partial cds.
GenBankAY0829612e-38AY082961.1 Hordeum vulgare clone HVSMEc0008O24f CONSTANS-like protein CO6 (CO6) mRNA, complete cds.
GenBankAY0829622e-38AY082962.1 Hordeum vulgare clone HVSMEb0009D03f CONSTANS-like protein CO6 (CO6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951711.11e-117PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLK3YT921e-117K3YT92_SETIT; Uncharacterized protein
STRINGSi017487m1e-117(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.13e-16CONSTANS-like 5